Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

JAK3 Rabbit pAb (A0748)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - JAK3 Rabbit pAb (A0748)

Western blot analysis of various lysates, using JAK3 Rabbit pAb (A0748) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - JAK3 Rabbit pAb (A0748)

Immunofluorescence analysis of TF-1 cells using JAK3 Rabbit pAb (A0748) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name JAK3 Rabbit pAb
Catalog No. A0748
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-530 of JAK3 (NP_000206.2).
Sequence RLTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNPLGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHG
Gene ID 3718
Swiss prot P52333
Synonyms JAKL; LJAK; JAK-3; L-JAK; JAK3_HUMAN; JAK3
Calculated MW 125kDa
Observed MW 115kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HEL
Cellular location Cytoplasm, Endomembrane system, Peripheral membrane protein
Customer validation

WB (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

JAK3 Rabbit pAb images

ABclonal:Western blot - JAK3 Rabbit pAb (A0748)}

Western blot - JAK3 Rabbit pAb (A0748)

Western blot analysis of various lysates, using JAK3 Rabbit pAb (A0748) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
ABclonal:Immunofluorescence - JAK3 Rabbit pAb (A0748)}

Immunofluorescence - JAK3 Rabbit pAb (A0748)

Immunofluorescence analysis of TF-1 cells using JAK3 Rabbit pAb (A0748) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0748 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on JAK3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to JAK3. (Distance between topics and target gene indicate popularity.) JAK3

* Data provided by citexs.com, for reference only.

Publishing research using A0748? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order