Product Type > Antibodies > Tag and Loading Control Antibodies

HRP-conjugated Mouse anti GST-Tag mAb (AE027)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Species independent

ABclonal:Western blot - HRP-conjugated Mouse anti GST-Tag mAb (AE027)

Western blot analysis of recombinant GST Protein using HRP-conjugated Mouse anti GST-Tag mAb (AE027) at 1:5000 dilution.
Lysates/proteins: 20 ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name HRP-conjugated Mouse anti GST-Tag mAb
Catalog No. AE027
Host species Mouse
Purification method Affinity purification
Isotype igg2b, Kappa
CloneNo. AMC0513

Background

Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.

Immunogen information

Immunogen Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein.
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Gene ID
Swiss prot
Synonyms GST; GST tag; GST-tag
Calculated MW 26kDa
Observed MW Refer to Figures

Applications

Reactivity Species independent
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location
Customer validation

WB (Homo sapiens, Escherichia coli, Glycine max)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

HRP-conjugated Mouse anti GST-Tag mAb images

ABclonal:Western blot - HRP-conjugated Mouse anti GST-Tag mAb (AE027)}

Western blot - HRP-conjugated Mouse anti GST-Tag mAb (AE027)

Western blot analysis of recombinant GST Protein using HRP-conjugated Mouse anti GST-Tag mAb (AE027) at 1:5000 dilution.
Lysates/proteins: 20 ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about AE027 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GST. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GST. (Distance between topics and target gene indicate popularity.) GST

* Data provided by citexs.com, for reference only.

Publishing research using AE027? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order