Publications (3) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Species independent
Product name | HRP-conjugated Mouse anti GST-Tag mAb |
---|---|
Catalog No. | AE027 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | igg2b, Kappa |
CloneNo. | AMC0513 |
Immunogen | Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein. |
---|---|
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK |
Gene ID | |
Swiss prot | |
Synonyms | GST; GST tag; GST-tag |
Calculated MW | 26kDa |
Observed MW | Refer to Figures |
Reactivity | Species independent |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | |
Cellular location | |
Customer validation | WB (Homo sapiens, Escherichia coli, Glycine max) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about AE027 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on GST. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to GST. (Distance between topics and target gene indicate popularity.) GST
* Data provided by citexs.com, for reference only.
Publishing research using AE027? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.