Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Review (1) Publications (130) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Western blot analysis of A549, using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunohistochemistry analysis of paraffin-embedded human liver using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunofluorescence analysis of HeLa cells using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A1346) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunofluorescence analysis of HepG2 cells using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb(A1346)

You may also interested in:

Overview

Product name Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb
Catalog No. A1346
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-288 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).
Sequence MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Gene ID 3162
Swiss prot P09601
Synonyms HO-1; HSP32; HMOX1D; bK286B10; Heme Oxygenase 1 (HO-1/HMOX1)
Calculated MW 33kDa
Observed MW 33kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A549
Cellular location Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein
Customer validation

WB (Mouse liverMus musculus, Mus musculus, Rattus norvegicus, Struthio camelus, Homo sapiens, Cyprinus carpio, Gallus gallus, Vaccinium dunalianum, H. cordata, Bos taurus, Chrysanthemum, Oryza sativa, Sus scrofa)

IF (Mus musculus, Homo sapiens)

ICH (Chrysanthemum)

IHC (Rattus norvegicus)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb images

ABclonal:Western blot - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)}

Western blot - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Western blot analysis of A549, using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)}

Immunohistochemistry - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunohistochemistry analysis of paraffin-embedded human liver using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)}

Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunofluorescence analysis of HeLa cells using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A1346) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)}

Immunofluorescence - Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346)

Immunofluorescence analysis of HepG2 cells using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A1346) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A1346

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1346 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HMOX1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HMOX1. (Distance between topics and target gene indicate popularity.) HMOX1

* Data provided by citexs.com, for reference only.

Publishing research using A1346? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order