Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HIF1α Rabbit pAb (A6265)

Reviews (3) Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HIF1α Rabbit pAb (A6265)

Western blot analysis of lysates from NIH/3T3 cells, using HIF1α Rabbit pAb (A6265) at 1:630 dilution.NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - HIF1α Rabbit pAb (A6265)

Western blot analysis of lysates from NIH/3T3 cells, using HIF1α Rabbit pAb (A6265) at 1:630 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Review
ABclonal: review for HIF1α Rabbit pAb(A6265)
Review
ABclonal: review for HIF1α Rabbit pAb(A6265)
Review
ABclonal: review for HIF1α Rabbit pAb(A6265)

You may also interested in:

Overview

Product name HIF1α Rabbit pAb
Catalog No. A6265
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-490 of HIF1α (NP_001521.1).
Sequence VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFT
Gene ID 3091
Swiss prot Q16665
Synonyms HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha; HIF1α
Calculated MW 93kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples NIH/3T3, Rat kidney
Cellular location Cytoplasm, Nucleus, Nucleus speckle
Customer validation

IHC (GL261)

IF (GL261)

WB (GL261Danio rerio, Danio rerio, Homo sapiens, Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HIF1α Rabbit pAb images

ABclonal:Western blot - HIF1α Rabbit pAb (A6265)}

Western blot - HIF1α Rabbit pAb (A6265)

Western blot analysis of lysates from NIH/3T3 cells, using HIF1α Rabbit pAb (A6265) at 1:630 dilution.NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - HIF1α Rabbit pAb (A6265)}

Western blot - HIF1α Rabbit pAb (A6265)

Western blot analysis of lysates from NIH/3T3 cells, using HIF1α Rabbit pAb (A6265) at 1:630 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Submit an review for A6265

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6265 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HIF1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HIF1A. (Distance between topics and target gene indicate popularity.) HIF1A

* Data provided by citexs.com, for reference only.

Publishing research using A6265? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order