Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GDF15 Rabbit pAb (A0185)

Publications (11) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - GDF15 Rabbit pAb (A0185)

Western blot analysis of various lysates using GDF15 Rabbit pAb (A0185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - GDF15 Rabbit pAb (A0185)

Immunohistochemistry analysis of GDF15 in paraffin-embedded human placenta using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GDF15 Rabbit pAb (A0185)

Immunofluorescence analysis of BALB-3T3 cells using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - GDF15 Rabbit pAb (A0185)

Immunoprecipitation analysis of 200 μg extracts of HT-1080 cells using 3 μg GDF15 antibody (A0185). Western blot was performed from the immunoprecipitate using GDF15 antibody (A0185) at a dilution of 1:1000.

You may also interested in:

Overview

Product name GDF15 Rabbit pAb
Catalog No. A0185
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 49-308 of human GDF15 (NP_004855.2).
Sequence EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Gene ID 9518
Swiss prot Q99988
Synonyms PDF; MIC1; PLAB; MIC-1; NAG-1; PTGFB; GDF-15; GDF15
Calculated MW 34kDa
Observed MW 35kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples PC-3, HT-1080
Cellular location Secreted
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

IHC (Homo sapiens)

ChIP (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GDF15 Rabbit pAb images

ABclonal:Western blot - GDF15 Rabbit pAb (A0185)}

Western blot - GDF15 Rabbit pAb (A0185)

Western blot analysis of various lysates using GDF15 Rabbit pAb (A0185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - GDF15 Rabbit pAb (A0185)}

Immunohistochemistry - GDF15 Rabbit pAb (A0185)

Immunohistochemistry analysis of GDF15 in paraffin-embedded human placenta using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GDF15 Rabbit pAb (A0185)}

Immunofluorescence - GDF15 Rabbit pAb (A0185)

Immunofluorescence analysis of BALB-3T3 cells using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - GDF15 Rabbit pAb (A0185)}

Immunoprecipitation - GDF15 Rabbit pAb (A0185)

Immunoprecipitation analysis of 200 μg extracts of HT-1080 cells using 3 μg GDF15 antibody (A0185). Western blot was performed from the immunoprecipitate using GDF15 antibody (A0185) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A0185 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GDF15. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GDF15. (Distance between topics and target gene indicate popularity.) GDF15

* Data provided by citexs.com, for reference only.

Publishing research using A0185? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order