Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

c-Fos Rabbit pAb (A0236)

Publications (26) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - c-Fos Rabbit pAb (A0236)

Western blot analysis of lysates from HeLa cells, using c-Fos Rabbit pAb (A0236) at 1:1000 dilution.HeLa cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - c-Fos Rabbit pAb (A0236)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg c-Fos antibody (A0236). Western blot was performed from the immunoprecipitate using c-Fos antibody (A0236) at a dilution of 1:1000.

You may also interested in:

Overview

Product name c-Fos Rabbit pAb
Catalog No. A0236
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human c-Fos (NP_005243.1).
Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
Gene ID 2353
Swiss prot P01100
Synonyms p55; AP-1; C-FOS; c-Fos
Calculated MW 41kDa
Observed MW 55-60kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa
Cellular location Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens, Chlorocebus aethiops, Capra hircus)

IHC (Rattus norvegicus, Cervus nippon, Mus musculus)

qPCR (Rattus norvegicus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

c-Fos Rabbit pAb images

ABclonal:Western blot - c-Fos Rabbit pAb (A0236)}

Western blot - c-Fos Rabbit pAb (A0236)

Western blot analysis of lysates from HeLa cells, using c-Fos Rabbit pAb (A0236) at 1:1000 dilution.HeLa cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunoprecipitation - c-Fos Rabbit pAb (A0236)}

Immunoprecipitation - c-Fos Rabbit pAb (A0236)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg c-Fos antibody (A0236). Western blot was performed from the immunoprecipitate using c-Fos antibody (A0236) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A0236 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FOS. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FOS. (Distance between topics and target gene indicate popularity.) FOS

* Data provided by citexs.com, for reference only.

Publishing research using A0236? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order