Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FABP3 Rabbit pAb (A5312)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FABP3 Rabbit pAb (A5312)

Western blot analysis of lysates from Mouse heart, using FABP3 Rabbit pAb (A5312) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - FABP3 Rabbit pAb (A5312)

Immunohistochemistry analysis of FABP3 in paraffin-embedded human stomach cancer using FABP3 Rabbit pAb (A5312) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - FABP3 Rabbit pAb (A5312)

Immunofluorescence analysis of paraffin-embedded mouse kidney using FABP3 Rabbit pAb (A5312) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name FABP3 Rabbit pAb
Catalog No. A5312
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1).
Sequence MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Gene ID 2170
Swiss prot P05413
Synonyms MDGI; FABP11; H-FABP; M-FABP; O-FABP; FABP3
Calculated MW 15kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse heart
Cellular location Cytoplasm
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FABP3 Rabbit pAb images

ABclonal:Western blot - FABP3 Rabbit pAb (A5312)}

Western blot - FABP3 Rabbit pAb (A5312)

Western blot analysis of lysates from Mouse heart, using FABP3 Rabbit pAb (A5312) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - FABP3 Rabbit pAb (A5312)}

Immunohistochemistry - FABP3 Rabbit pAb (A5312)

Immunohistochemistry analysis of FABP3 in paraffin-embedded human stomach cancer using FABP3 Rabbit pAb (A5312) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - FABP3 Rabbit pAb (A5312)}

Immunofluorescence - FABP3 Rabbit pAb (A5312)

Immunofluorescence analysis of paraffin-embedded mouse kidney using FABP3 Rabbit pAb (A5312) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A5312 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FABP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FABP3. (Distance between topics and target gene indicate popularity.) FABP3

* Data provided by citexs.com, for reference only.

Publishing research using A5312? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order