Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EPOR Rabbit pAb (A2917)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - EPOR Rabbit pAb (A2917)

Western blot analysis of lysates from Mouse liver, using EPOR Rabbit pAb (A2917) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of paraffin-embedded Mouse fetal using EPOR Rabbit pAb (A2917) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of NIH/3T3 cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of PC-12 cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of SH-SY5Y cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name EPOR Rabbit pAb
Catalog No. A2917
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 274-508 of human EPOR (NP_000112.1).
Sequence HRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Gene ID 2057
Swiss prot P19235
Synonyms EPO-R; EPOR
Calculated MW 55kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation

WB (Rattus norvegicus, Homo sapiens)

IHC (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EPOR Rabbit pAb images

ABclonal:Western blot - EPOR Rabbit pAb (A2917)}

Western blot - EPOR Rabbit pAb (A2917)

Western blot analysis of lysates from Mouse liver, using EPOR Rabbit pAb (A2917) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)}

Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of paraffin-embedded Mouse fetal using EPOR Rabbit pAb (A2917) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)}

Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of NIH/3T3 cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)}

Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of PC-12 cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - EPOR Rabbit pAb (A2917)}

Immunofluorescence - EPOR Rabbit pAb (A2917)

Immunofluorescence analysis of SH-SY5Y cells using EPOR Rabbit pAb (A2917) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A2917 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EPOR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EPOR. (Distance between topics and target gene indicate popularity.) EPOR

* Data provided by citexs.com, for reference only.

Publishing research using A2917? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order