Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KD Validated] eIF4E Rabbit pAb (A2162)

Reviews (5) Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of various lysates, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of lysates from wild type (WT) and eIF4E knockdown (KD) 293T cells using [KO Validated] eIF4E Rabbit pAb (A2162) at 1:1400 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 10 s.

ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of lysates from wild type(WT) and eIF4E knockdown (KD) 293T cells, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry analysis of eIF4E in paraffin-embedded human lung cancer using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry analysis of eIF4E in paraffin-embedded human stomach using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunofluorescence analysis of U2OS cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg [KD Validated] eIF4E Rabbit pAb (A2162). Western blot was performed from the immunoprecipitate using [KD Validated] eIF4E Rabbit pAb at a dilution of 1:1000.

Review
ABclonal: review for [KD Validated] eIF4E Rabbit pAb(A2162)
Review
ABclonal: review for [KD Validated] eIF4E Rabbit pAb(A2162)
Review
ABclonal: review for [KD Validated] eIF4E Rabbit pAb(A2162)
Review
ABclonal: review for [KD Validated] eIF4E Rabbit pAb(A2162)
Review
ABclonal: review for [KD Validated] eIF4E Rabbit pAb(A2162)

You may also interested in:

Overview

Product name [KD Validated] eIF4E Rabbit pAb
Catalog No. A2162
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Sequence MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Gene ID 1977
Swiss prot P06730
Synonyms CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; 4E
Calculated MW 25kDa
Observed MW 25kDa/28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, HeLa, K-562, 293T
Cellular location Cytoplasm, P-body
Customer validation

IF (RD cellHomo sapiens, Homo sapiens)

WB (Human cells, HEK293T, A172Homo sapiens, Microplitis bicoloratus bracovirus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] eIF4E Rabbit pAb images

ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)}

Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of various lysates, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)}

Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of lysates from wild type (WT) and eIF4E knockdown (KD) 293T cells using [KO Validated] eIF4E Rabbit pAb (A2162) at 1:1400 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 10 s.
ABclonal:Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)}

Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Western blot analysis of lysates from wild type(WT) and eIF4E knockdown (KD) 293T cells, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
ABclonal:Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)}

Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry analysis of eIF4E in paraffin-embedded human lung cancer using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)}

Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry analysis of eIF4E in paraffin-embedded human stomach using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KD Validated] eIF4E Rabbit pAb (A2162)}

Immunofluorescence - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunofluorescence analysis of U2OS cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KD Validated] eIF4E Rabbit pAb (A2162)}

Immunoprecipitation - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg [KD Validated] eIF4E Rabbit pAb (A2162). Western blot was performed from the immunoprecipitate using [KD Validated] eIF4E Rabbit pAb at a dilution of 1:1000.

Submit an review for A2162

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2162 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF4E. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF4E. (Distance between topics and target gene indicate popularity.) EIF4E

* Data provided by citexs.com, for reference only.

Publishing research using A2162? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order