Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

eIF4A1 Rabbit pAb (A5294)

Reviews (3) Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - eIF4A1 Rabbit pAb (A5294)

Western blot analysis of various lysates, using eIF4A1 Rabbit pAb (A5294) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - eIF4A1 Rabbit pAb (A5294)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg eIF4A1 antibody (A5294). Western blot was performed from the immunoprecipitate using eIF4A1 antibody (A5294) at a dilution of 1:1000.

Review
ABclonal: review for eIF4A1 Rabbit pAb(A5294)
Review
ABclonal: review for eIF4A1 Rabbit pAb(A5294)
Review
ABclonal: review for eIF4A1 Rabbit pAb(A5294)

You may also interested in:

Overview

Product name eIF4A1 Rabbit pAb
Catalog No. A5294
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables double-stranded RNA binding activity. Predicted to be involved in cytoplasmic translational initiation. Located in cytoplasm.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1).
Sequence MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
Gene ID 1973
Swiss prot P60842
Synonyms DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; eIF4A1
Calculated MW 46kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HepG2, 293T, C2C12, C6, Mouse brain
Cellular location cytoplasm, cytosol, eukaryotic translation initiation factor 4F complex, extracellular exosome
Customer validation

IF (RD cellHomo sapiens, Homo sapiens)

IP (MESC)

WB (Human cellsMus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eIF4A1 Rabbit pAb images

ABclonal:Western blot - eIF4A1 Rabbit pAb (A5294)}

Western blot - eIF4A1 Rabbit pAb (A5294)

Western blot analysis of various lysates, using eIF4A1 Rabbit pAb (A5294) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - eIF4A1 Rabbit pAb (A5294)}

Immunofluorescence - eIF4A1 Rabbit pAb (A5294)

Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - eIF4A1 Rabbit pAb (A5294)}

Immunoprecipitation - eIF4A1 Rabbit pAb (A5294)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg eIF4A1 antibody (A5294). Western blot was performed from the immunoprecipitate using eIF4A1 antibody (A5294) at a dilution of 1:1000.

Submit an review for A5294

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5294 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF4A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF4A1. (Distance between topics and target gene indicate popularity.) EIF4A1

* Data provided by citexs.com, for reference only.

Publishing research using A5294? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order