Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DNMT3A Rabbit pAb (A2065)

Reviews (5) Publications (10) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - DNMT3A Rabbit pAb (A2065)

Western blot analysis of various lysates using DNMT3A Rabbit pAb (A2065) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunoprecipitation - DNMT3A Rabbit pAb (A2065)

Immunoprecipitation analysis of 200 μg extracts of A-549 cells using 3 μg DNMT3A antibody (A2065). Western blot was performed from the immunoprecipitate using DNMT3A antibody (A2065) at a dilution of 1:1000.

Review
ABclonal: review for DNMT3A Rabbit pAb(A2065)
Review
ABclonal: review for DNMT3A Rabbit pAb(A2065)
Review
ABclonal: review for DNMT3A Rabbit pAb(A2065)
Review
ABclonal: review for DNMT3A Rabbit pAb(A2065)
Review
ABclonal: review for DNMT3A Rabbit pAb(A2065)

You may also interested in:

Overview

Product name DNMT3A Rabbit pAb
Catalog No. A2065
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human DNMT3A (NP_072046.2).
Sequence MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAV
Gene ID 1788
Swiss prot Q9Y6K1
Synonyms TBRS; HESJAS; DNMT3A2; M.HsaIIIA; DNMT3A
Calculated MW 102kDa
Observed MW 110kDa/130kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples A-549, 293T, HeLa, HL-60, MCF7, HepG2, Mouse testis
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Human hepatocellular carcinoma cell line, HCT116, Human cells, BEL-7402, SMMC7721Homo sapiens, Homo sapiens, Rattus norvegicus, Mus musculus)

ChIP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DNMT3A Rabbit pAb images

ABclonal:Western blot - DNMT3A Rabbit pAb (A2065)}

Western blot - DNMT3A Rabbit pAb (A2065)

Western blot analysis of various lysates using DNMT3A Rabbit pAb (A2065) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunoprecipitation - DNMT3A Rabbit pAb (A2065)}

Immunoprecipitation - DNMT3A Rabbit pAb (A2065)

Immunoprecipitation analysis of 200 μg extracts of A-549 cells using 3 μg DNMT3A antibody (A2065). Western blot was performed from the immunoprecipitate using DNMT3A antibody (A2065) at a dilution of 1:1000.

Submit an review for A2065

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2065 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DNMT3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DNMT3A. (Distance between topics and target gene indicate popularity.) DNMT3A

* Data provided by citexs.com, for reference only.

Publishing research using A2065? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order