Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cystatin C Rabbit pAb (A1561)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cystatin C Rabbit pAb (A1561)

Western blot analysis of Hep G2, using Cystatin C Rabbit pAb (A1561) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Cystatin C Rabbit pAb (A1561)

Immunofluorescence analysis of HeLa cells using Cystatin C antibody (A1561). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Cystatin C Rabbit pAb
Catalog No. A1561
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human Cystatin C (NP_000090.1).
Sequence MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Gene ID 1471
Swiss prot P01034
Synonyms ARMD11; HEL-S-2; Cystatin C
Calculated MW 13kDa
Observed MW 13kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:10 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Hep G2
Cellular location Secreted
Customer validation

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Mus musculus)

/ (/)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cystatin C Rabbit pAb images

ABclonal:Western blot - Cystatin C Rabbit pAb (A1561)}

Western blot - Cystatin C Rabbit pAb (A1561)

Western blot analysis of Hep G2, using Cystatin C Rabbit pAb (A1561) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - Cystatin C Rabbit pAb (A1561)}

Immunofluorescence - Cystatin C Rabbit pAb (A1561)

Immunofluorescence analysis of HeLa cells using Cystatin C antibody (A1561). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1561 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CST3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CST3. (Distance between topics and target gene indicate popularity.) CST3

* Data provided by citexs.com, for reference only.

Publishing research using A1561? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order