Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cyclin B1 Rabbit pAb (A0381)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - Cyclin B1 Rabbit pAb (A0381)

Western blot analysis of lysates from HepG2 cells, using Cyclin B1 Rabbit pAb (A0381).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

You may also interested in:

Overview

Product name Cyclin B1 Rabbit pAb
Catalog No. A0381
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-433 of human Cyclin B1 (NP_114172.1).
Sequence CLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Gene ID 891
Swiss prot P14635
Synonyms CCNB; Cyclin B1
Calculated MW 48kDa
Observed MW 60kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2
Cellular location Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Customer validation

WB (Homo sapiens, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cyclin B1 Rabbit pAb images

ABclonal:Western blot - Cyclin B1 Rabbit pAb (A0381)}

Western blot - Cyclin B1 Rabbit pAb (A0381)

Western blot analysis of lysates from HepG2 cells, using Cyclin B1 Rabbit pAb (A0381).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Inquire About This Product

Submit your question about A0381 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCNB1. (Distance between topics and target gene indicate popularity.) CCNB1

* Data provided by citexs.com, for reference only.

Publishing research using A0381? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order