Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CAMKK2 Rabbit pAb (A9899)

Review (1) Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CAMKK2 Rabbit pAb (A9899)

Western blot analysis of extracts of various cell lines, using CAMKK2 antibody (A9899) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - CAMKK2 Rabbit pAb (A9899)

Immunofluorescence analysis of PC-3 cells using CAMKK2 Rabbit pAb (A9899) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for CAMKK2 Rabbit pAb(A9899)

You may also interested in:

Overview

Product name CAMKK2 Rabbit pAb
Catalog No. A9899
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CAMKK2 (NP_006540.3).
Sequence MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS
Gene ID 10645
Swiss prot Q96RR4
Synonyms CAMKK; CAMKKB; CAMKK2
Calculated MW 65kDa
Observed MW 68kDa/70kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, SH-SY5Y, LNCaP
Cellular location Cell projection, Cytoplasm, Nucleus
Customer validation

WB (Rabbit cerebral microvascular endothelial cellsMus musculus, Macaca mulatta, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CAMKK2 Rabbit pAb images

ABclonal:Western blot - CAMKK2 Rabbit pAb (A9899)}

Western blot - CAMKK2 Rabbit pAb (A9899)

Western blot analysis of extracts of various cell lines, using CAMKK2 antibody (A9899) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - CAMKK2 Rabbit pAb (A9899)}

Immunofluorescence - CAMKK2 Rabbit pAb (A9899)

Immunofluorescence analysis of PC-3 cells using CAMKK2 Rabbit pAb (A9899) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A9899

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A9899 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CAMKK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CAMKK2. (Distance between topics and target gene indicate popularity.) CAMKK2

* Data provided by citexs.com, for reference only.

Publishing research using A9899? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order