Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BDNF Rabbit pAb (A1307)

Reviews (2) Publications (26) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - BDNF Rabbit pAb (A1307)

Western blot analysis of various lysates using BDNF Rabbit pAb (A1307) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review
ABclonal: review for BDNF Rabbit pAb(A1307)
Review
ABclonal: review for BDNF Rabbit pAb(A1307)

You may also interested in:

Overview

Product name BDNF Rabbit pAb
Catalog No. A1307
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human BDNF (NP_733928.1).
Sequence PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Gene ID 627
Swiss prot P23560
Synonyms ANON2; BULN2; BDNF
Calculated MW 28kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, U-87 MG, Mouse lung
Cellular location Secreted
Customer validation

WB (Rat brainRattus norvegicus, Rattus norvegicus, Mus musculus, Homo sapiens)

IF (Rattus norvegicus)

ELISA (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BDNF Rabbit pAb images

ABclonal:Western blot - BDNF Rabbit pAb (A1307)}

Western blot - BDNF Rabbit pAb (A1307)

Western blot analysis of various lysates using BDNF Rabbit pAb (A1307) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Submit an review for A1307

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1307 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BDNF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BDNF. (Distance between topics and target gene indicate popularity.) BDNF

* Data provided by citexs.com, for reference only.

Publishing research using A1307? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order