Product Type > Antibodies > Primary Antibodies > Acetyl-specific Antibodies

Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Publications (64) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from HeLa cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from NIH/3T3 cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from C6 cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded human mammary cancer using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded human colon using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded rat ovary using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded mouse brain using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunofluorescence analysis of HeLa cells using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:100 (40x lens). HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours (left). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunofluorescence analysis of NIH/3T3 cells using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:100 (40x lens). NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours (left). Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K9 antibody (A7255) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name Acetyl-Histone H3-K9 Rabbit pAb
Catalog No. A7255
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K9
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • ChIP-seq 1:20 - 1:50
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, NIH/3T3, C6
Cellular location Chromosome, Nucleus
Customer validation

ChIP (Rattus norvegicus, Homo sapiens, Arabidopsis thaliana, Mus musculus, Oryza sativa, Plasmodium)

IHC (Rattus norvegicus)

IP (Rattus norvegicus, Mus musculus)

WB (Rattus norvegicus, Homo sapiens, Bombyx mori Linnaeus, Mus musculus, Oryza sativa, Sus scrofa, Nicotiana benthamiana, Saccharomyces cerevisiae, Danio rerio, Plasmodium, Other)

IF (Sus scrofa, Mus musculus, Rattus norvegicus, Homo sapiens)

CHIP (Mus musculus, Rattus norvegicus)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Acetyl-Histone H3-K9 Rabbit pAb images

ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from HeLa cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from NIH/3T3 cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Western blot - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Western blot analysis of lysates from C6 cells, using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at 1:1000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded human mammary cancer using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded human colon using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded rat ovary using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunohistochemistry - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunohistochemistry analysis of Acetyl-Histone H3-K9 in paraffin-embedded mouse brain using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunofluorescence analysis of HeLa cells using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:100 (40x lens). HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours (left). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Immunofluorescence - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Immunofluorescence analysis of NIH/3T3 cells using Acetyl-Histone H3-K9 Rabbit pAb (A7255) at dilution of 1:100 (40x lens). NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours (left). Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H3-K9 Rabbit pAb (A7255)}

Chromatin Immunoprecipitation - Acetyl-Histone H3-K9 Rabbit pAb (A7255)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K9 antibody (A7255) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A7255 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H3-4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H3-4. (Distance between topics and target gene indicate popularity.) H3-4

* Data provided by citexs.com, for reference only.

Publishing research using A7255? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order