Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Arginase 1 (ARG1) Rabbit pAb (A1847)

Reviews (2) Publications (45) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Arginase 1 (ARG1) Rabbit pAb (A1847)

Western blot analysis of various lysates using Arginase 1 (ARG1) Rabbit pAb (A1847) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Arginase 1 (ARG1) Rabbit pAb (A1847)

Immunofluorescence analysis of paraffin-embedded human liver cancer using Arginase 1 (ARG1) Rabbit pAb (A1847) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Arginase 1 (ARG1) Rabbit pAb(A1847)
Review
ABclonal: review for Arginase 1 (ARG1) Rabbit pAb(A1847)

You may also interested in:

Overview

Product name Arginase 1 (ARG1) Rabbit pAb
Catalog No. A1847
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human Arginase 1 (ARG1) (NP_000036.2).
Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Gene ID 383
Swiss prot P05089
Synonyms ARG1; arginase-1; Arginase 1 (ARG1)
Calculated MW 35kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver, Rat liver
Cellular location Cytoplasm
Customer validation

WB (Adenocarcinoma human alveolar basal epithelial cells, Raw264.7Mus musculus, Mus musculus, Rattus norvegicus, Homo sapiens, Rattusnorvegicus)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

IF (Homo sapiens, Mus musculus)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Arginase 1 (ARG1) Rabbit pAb images

ABclonal:Western blot - Arginase 1 (ARG1) Rabbit pAb (A1847)}

Western blot - Arginase 1 (ARG1) Rabbit pAb (A1847)

Western blot analysis of various lysates using Arginase 1 (ARG1) Rabbit pAb (A1847) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - Arginase 1 (ARG1) Rabbit pAb (A1847)}

Immunofluorescence - Arginase 1 (ARG1) Rabbit pAb (A1847)

Immunofluorescence analysis of paraffin-embedded human liver cancer using Arginase 1 (ARG1) Rabbit pAb (A1847) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1847

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1847 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ARG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ARG1. (Distance between topics and target gene indicate popularity.) ARG1

* Data provided by citexs.com, for reference only.

Publishing research using A1847? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order