Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Alpha-Fetoprotein (AFP) Rabbit pAb (A0200)

Review (1) Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Alpha-Fetoprotein (AFP) Rabbit pAb (A0200)

Western blot analysis of various lysates, using Alpha-Fetoprotein (AFP) Rabbit pAb (A0200) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review
ABclonal: review for Alpha-Fetoprotein (AFP) Rabbit pAb(A0200)

You may also interested in:

Overview

Product name Alpha-Fetoprotein (AFP) Rabbit pAb
Catalog No. A0200
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatocarcinoma and with teratoma, and has prognostic value for managing advanced gastric cancer. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-609 of human Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) (NP_001125.1).
Sequence RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Gene ID 174
Swiss prot P02771
Synonyms AFPD; FETA; HPAFP; Alpha-Fetoprotein (AFP)
Calculated MW 69kDa
Observed MW 69kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Mouse liver, Rat liver
Cellular location Secreted
Customer validation

IHC (Murine liverMus musculus, Homo sapiens)

IF (Mus musculus, Homo sapiens)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Alpha-Fetoprotein (AFP) Rabbit pAb images

ABclonal:Western blot - Alpha-Fetoprotein (AFP) Rabbit pAb (A0200)}

Western blot - Alpha-Fetoprotein (AFP) Rabbit pAb (A0200)

Western blot analysis of various lysates, using Alpha-Fetoprotein (AFP) Rabbit pAb (A0200) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Submit an review for A0200

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0200 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AFP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AFP. (Distance between topics and target gene indicate popularity.) AFP

* Data provided by citexs.com, for reference only.

Publishing research using A0200? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order