Review (1) Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Alpha-Fetoprotein (AFP) Rabbit pAb |
---|---|
Catalog No. | A0200 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-609 of human Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) (NP_001125.1). |
---|---|
Sequence | RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV |
Gene ID | 174 |
Swiss prot | P02771 |
Synonyms | AFPD; FETA; HPAFP; Alpha-Fetoprotein (AFP) |
Calculated MW | 69kDa |
Observed MW | 69kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HepG2, Mouse liver, Rat liver |
Cellular location | Secreted |
Customer validation | IHC (Murine liverMus musculus, Homo sapiens) IF (Mus musculus, Homo sapiens) WB (Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0200 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on AFP. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to AFP. (Distance between topics and target gene indicate popularity.) AFP
* Data provided by citexs.com, for reference only.
Publishing research using A0200? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.