Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ACSL5 Rabbit pAb (A1270)

Review (1) Publications (4) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ACSL5 Rabbit pAb (A1270)

Western blot analysis of extracts of various cell lines, using ACSL5 antibody (A1270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review
ABclonal: review for ACSL5 Rabbit pAb(A1270)

You may also interested in:

Overview

Product name ACSL5 Rabbit pAb
Catalog No. A1270
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-739 of human ACSL5 (NP_057318.2).
Sequence GQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD
Gene ID 51703
Swiss prot Q9ULC5
Synonyms ACS2; ACS5; FACL5; ACSL5
Calculated MW 76kDa
Observed MW 70-76kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, HL-60, Mouse liver, Rat liver
Cellular location Endoplasmic reticulum, Endoplasmic reticulum membrane, Mitochondrion, Mitochondrion outer membrane, Single-pass type III membrane protein
Customer validation

WB (Mouse brown fat cellsHomo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens)

ACSL5 Rabbit pAb images

ABclonal:Western blot - ACSL5 Rabbit pAb (A1270)}

Western blot - ACSL5 Rabbit pAb (A1270)

Western blot analysis of extracts of various cell lines, using ACSL5 antibody (A1270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Submit an review for A1270

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1270 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACSL5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACSL5. (Distance between topics and target gene indicate popularity.) ACSL5

* Data provided by citexs.com, for reference only.

Publishing research using A1270? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order